Class g: Small proteins [56992] (98 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.0: automated matches [254264] (1 protein) not a true family |
Protein automated matches [254611] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255500] (7 PDB entries) |
Domain d6ilke1: 6ilk E:62-129 [368863] Other proteins in same PDB: d6ilka_, d6ilkc_ automated match to d1nwva1 complexed with sph |
PDB Entry: 6ilk (more details), 3 Å
SCOPe Domain Sequences for d6ilke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ilke1 g.18.1.0 (E:62-129) automated matches {Human (Homo sapiens) [TaxId: 9606]} cnrscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwst avefckkk
Timeline for d6ilke1: