SCOPe 2.07: Domain d6ilke1: 6ilk E:62-129

Lineage for d6ilke1 (6ilk E:62-129)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.0: automated matches [254264] (1 protein)
   not a true family

6. Protein automated matches [254611] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255500] (7 PDB entries)

8. Domain d6ilke1: 6ilk E:62-129 [368863]
   Other proteins in same PDB: d6ilka_, d6ilkc_
   automated match to d1nwva1
   complexed with sph

Details for d6ilke1

PDB Entry: 6ilk, 3 Å

PDB Description: cryo-em structure of echovirus 6 complexed with its attachment receptor cd55 at ph 7.4

PDB Compounds: (E:) complement decay-accelerating factor

SCOPe Domain Sequences for d6ilke1:

Sequence; same for both SEQRES and ATOM records:

>d6ilke1 g.18.1.0 (E:62-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cnrscevptrlnsaslkqpyitqnyfpvgtvveyecrpgyrrepslspkltclqnlkwst
avefckkk

Timeline for d6ilke1:

• d6ilke1 is new in SCOPe 2.07-stable
  
• d6ilke1 appears in the current release, SCOPe 2.08