SCOPe 2.07: Domain d6dfma2: 6dfm A:214-407

Lineage for d6dfma2 (6dfm A:214-407)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (68 PDB entries)

8. Domain d6dfma2: 6dfm A:214-407 [368805]
   automated match to d3iucc2
   complexed with 3bh

Details for d6dfma2

PDB Entry: 6dfm, 2.14 Å

PDB Description: crystal structure of human grp78 in complex with 8-aminoadenosine

PDB Compounds: (A:) Endoplasmic reticulum chaperone BiP

SCOPe Domain Sequences for d6dfma2:

Sequence; same for both SEQRES and ATOM records:

>d6dfma2 c.55.1.0 (A:214-407) automated matches {Human (Homo sapiens) [TaxId: 9606]}
regeknilvfdlgggtfdvslltidngvfevvatngdthlggedfdqrvmehfiklykkk
tgkdvrkdnravqklrrevekakralssqhqarieiesfyegedfsetltrakfeelnmd
lfrstmkpvqkvledsdlkksdideivlvggstripkiqqlvkeffngkepsrginpdea
vaygaavqagvlsg

Timeline for d6dfma2:

• d6dfma2 is new in SCOPe 2.07-stable
  
• d6dfma2 appears in the current release, SCOPe 2.08