Lineage for d6de9a1 (6de9 A:32-105)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643721Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
    Fe-S binding region and beta cap
  4. 2643722Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families) (S)
    Pfam PF09360; PubMed 17766440
  5. 2643723Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)
  6. 2643728Protein automated matches [310858] (1 species)
    not a true protein
  7. 2643729Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries)
  8. 2643772Domain d6de9a1: 6de9 A:32-105 [368794]
    Other proteins in same PDB: d6de9a2
    automated match to d3lpqa_
    complexed with fes, fun

Details for d6de9a1

PDB Entry: 6de9 (more details), 1.95 Å

PDB Description: mitoneet bound to furosemide
PDB Compounds: (A:) CDGSH iron-sulfur domain-containing protein 1

SCOPe Domain Sequences for d6de9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6de9a1 g.97.1.1 (A:32-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgahtkhn
eetgdnvgpliikk

SCOPe Domain Coordinates for d6de9a1:

Click to download the PDB-style file with coordinates for d6de9a1.
(The format of our PDB-style files is described here.)

Timeline for d6de9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6de9a2