Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.0: automated matches [191580] (1 protein) not a true family |
Protein automated matches [191036] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries) |
Domain d5qp9a_: 5qp9 A: [368748] automated match to d5mp0d_ complexed with act, dms, edo, ljd |
PDB Entry: 5qp9 (more details), 1.72 Å
SCOPe Domain Sequences for d5qp9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5qp9a_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvptygaiildetlenvllvqgylaksgwgfpkgkvnkeeaphdcaarevfeetgfdikd yickddyielrindqlarlyiipgipkdtkfnpktrreirniewfsieklpchrndmtpk sklglapnkffmaipfirplrdwlsrrfg
Timeline for d5qp9a_: