Lineage for d6nlli_ (6nll I:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2316104Species Pseudomonas aeruginosa [TaxId:287] [189215] (23 PDB entries)
  8. 2316221Domain d6nlli_: 6nll I: [368618]
    automated match to d4e6ka_
    complexed with fe2, hem, kt4, pg4

Details for d6nlli_

PDB Entry: 6nll (more details), 1.8 Å

PDB Description: 1.80 a resolution structure of wt bfrb from pseudomonas aeruginosa in complex with a protein-protein interaction inhibitor (analog 14)
PDB Compounds: (I:) Ferroxidase

SCOPe Domain Sequences for d6nlli_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nlli_ a.25.1.1 (I:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mkgdkkviqhlnkilgneliainqyflhsrmwndwglkrlgaheyhesidemkhadklie
rilfleglpnlqdlgklligentqemlqcdlnlelkatkdlreaivhceqvhdyvsrdll
kdileseeehidyletqlgliqkvglenylqshmh

SCOPe Domain Coordinates for d6nlli_:

Click to download the PDB-style file with coordinates for d6nlli_.
(The format of our PDB-style files is described here.)

Timeline for d6nlli_: