Lineage for d6onab2 (6ona B:330-491)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646539Species Influenza a virus (strain a/hickox/1940 h1n1) [TaxId:383543] [368447] (1 PDB entry)
  8. 2646541Domain d6onab2: 6ona B:330-491 [368452]
    Other proteins in same PDB: d6onaa1, d6onaa3, d6onab1, d6onab3, d6onac1, d6onac3
    automated match to d4wsrd2
    complexed with bma, cl, nag, peg

Details for d6onab2

PDB Entry: 6ona (more details), 1.95 Å

PDB Description: crystal structure of influenza hemagglutinin from strain a/hickox/jy2/1940
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d6onab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6onab2 h.3.1.0 (B:330-491) automated matches {Influenza a virus (strain a/hickox/1940 h1n1) [TaxId: 383543]}
glfgaiagfieggwagmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvknqlrnnakeigngcfefyhkcnnecmesvkngtydypky

SCOPe Domain Coordinates for d6onab2:

Click to download the PDB-style file with coordinates for d6onab2.
(The format of our PDB-style files is described here.)

Timeline for d6onab2: