Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.0: automated matches [254278] (1 protein) not a true family |
Protein automated matches [254645] (42 species) not a true protein |
Species Influenza a virus (strain a/hickox/1940 h1n1) [TaxId:383543] [368447] (1 PDB entry) |
Domain d6onab2: 6ona B:330-491 [368452] Other proteins in same PDB: d6onaa1, d6onaa3, d6onab1, d6onab3, d6onac1, d6onac3 automated match to d4wsrd2 complexed with bma, cl, nag, peg |
PDB Entry: 6ona (more details), 1.95 Å
SCOPe Domain Sequences for d6onab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6onab2 h.3.1.0 (B:330-491) automated matches {Influenza a virus (strain a/hickox/1940 h1n1) [TaxId: 383543]} glfgaiagfieggwagmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn tqftavgkefnklekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye kvknqlrnnakeigngcfefyhkcnnecmesvkngtydypky
Timeline for d6onab2: