SCOPe 2.07: Domain d6i8ta1: 6i8t A:662-796

Lineage for d6i8ta1 (6i8t A:662-796)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.0: automated matches [227223] (1 protein)
   not a true family

6. Protein automated matches [226964] (2 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [368393] (2 PDB entries)

8. Domain d6i8ta1: 6i8t A:662-796 [368409]
   Other proteins in same PDB: d6i8ta2
   automated match to d4hhyd1
   protein/DNA complex; complexed with h7z

Details for d6i8ta1

PDB Entry: 6i8t, 2.1 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with an isoindolinone inhibitor

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d6i8ta1:

Sequence; same for both SEQRES and ATOM records:

>d6i8ta1 a.41.1.0 (A:662-796) automated matches {Gallus gallus [TaxId: 9031]}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

Timeline for d6i8ta1:

• d6i8ta1 is new in SCOPe 2.07-stable
  
• d6i8ta1 appears in the current release, SCOPe 2.08