Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Escherichia coli [TaxId:83333] [348468] (2 PDB entries) |
Domain d6gcmg_: 6gcm g: [368408] Other proteins in same PDB: d6gcma_, d6gcmb_, d6gcmd_ automated match to d1f33f_ |
PDB Entry: 6gcm (more details), 2.45 Å
SCOPe Domain Sequences for d6gcmg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gcmg_ a.25.1.1 (g:) automated matches {Escherichia coli [TaxId: 83333]} llytrndvsdsekkatvellnrqviqfidlslitkqahwnmrganfiavhemldgfrtal idhldtmaeravqlggvalgttqvinsktplksypldihnvqdhlkeladryaivandvr kaigeakdddtadiltaasrdldkflwfiesnie
Timeline for d6gcmg_: