Lineage for d6d8xa1 (6d8x A:203-477)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
multihelical; 3 layers or orthogonally packed helicesSuperfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) 
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) 
Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species) Species Human (Homo sapiens) [TaxId:9606] [48525] (167 PDB entries)
Uniprot P37231 232-505
Domain d6d8xa1: 6d8x A:203-477 [368334]
Other proteins in same PDB: d6d8xa2
automated match to d3prga_
protein/DNA complex; complexed with edk, flc, gol, na
Details for d6d8xa1
PDB Entry: 6d8x (more details), 1.9 Å
PDB Description: ppar gamma lbd complexed with the agonist gw1929
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gammaSCOPe Domain Sequences for d6d8xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d8xa1 a.123.1.1 (A:203-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
qlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedki
kfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygv
heiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldds
dlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdl
rqivtehvqllqvikktetdmslhpllqeiykdly
SCOPe Domain Coordinates for d6d8xa1:
Click to download the PDB-style file with coordinates for d6d8xa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6d8xa1:
- d6d8xa1 is new in SCOPe 2.07-stable
- d6d8xa1 appears in the current release, SCOPe 2.08
View in 3D
