SCOPe 2.07: Domain d6d4ia1: 6d4i A:237-339

Lineage for d6d4ia1 (6d4i A:237-339)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (25 PDB entries)

8. Domain d6d4ia1: 6d4i A:237-339 [368322]
   automated match to d1hzhh3
   complexed with bma, fuc, man, nag

Details for d6d4ia1

PDB Entry: 6d4i, 2.95 Å

PDB Description: crystal structure of a fc fragment of rhesus macaque (macaca mulatta) igg2

PDB Compounds: (A:) Fc fragment of IgG2

SCOPe Domain Sequences for d6d4ia1:

Sequence; same for both SEQRES and ATOM records:

>d6d4ia1 b.1.1.2 (A:237-339) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
gpsvflfppkpkdtlmisrtpevtcvvvdvsqeepdvkfnwyvdgvevhnaqtkpreeqf
nstyrvvsvltvthqdwlngkeytckvsnkalpaprqktvskt

Timeline for d6d4ia1:

• d6d4ia1 is new in SCOPe 2.07-stable
  
• d6d4ia1 appears in the current release, SCOPe 2.08