Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Influenza a virus [TaxId:88776] [368302] (1 PDB entry) |
Domain d6d96a_: 6d96 A: [368312] automated match to d5huga_ complexed with ca, fuc, gol, nag |
PDB Entry: 6d96 (more details), 2.15 Å
SCOPe Domain Sequences for d6d96a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6d96a_ b.68.1.0 (A:) automated matches {Influenza a virus [TaxId: 88776]} viltgnsslcpisgwaiyskdngirigskgdvfvirepfiscshlecrtffltqgallnd khsngtvkdrspyrtlmscpvgeapspynsrfesvawsasachdgmgwltigisgpdnga vavlkyngiitdtikswrnnilrtqesecacvngscftimtdgpsngqasykilkiekgk vtksielnapnyhyeecscypdtgkvmcvcrdnwhgsnrpwvsfdqnldyqigyicsgvf gdnprpndgtgscgpvssngangikgfsfrydngvwigrtkstssrsgfemiwdpngwte tdssfsvrqdivaitdwsgysgsfvqhpeltgldcmrpcfwvelirgqpkentiwtsgss isfcgvnsdtvgwswpdgaelpfsid
Timeline for d6d96a_: