SCOP 1.65: Domain d1lyi__: 1lyi -

Lineage for d1lyi__ (1lyi -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (371 PDB entries)
   many mutant structures

8. Domain d1lyi__: 1lyi - [36821]
   complexed with cl, seo; mutant

Details for d1lyi__

PDB Entry: 1lyi, 2 Å

PDB Description: dissection of helix capping in t4 lysozyme by structural and thermodynamic analysis of six amino acid substitutions at thr 59

SCOP Domain Sequences for d1lyi__:

Sequence; same for both SEQRES and ATOM records:

>d1lyi__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvidk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d1lyi__:

• d1lyi__ first appeared (with stable ids) in SCOP 1.55
  
• d1lyi__ appears in SCOP 1.63
  
• d1lyi__ appears in SCOP 1.67
  
• d1lyi__ appears in the current release, SCOPe 2.08, called d1lyia_