Lineage for d1l84a_ (1l84 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2532819Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 2532825Protein Phage T4 lysozyme [53982] (1 species)
  7. 2532826Species Bacteriophage T4 [TaxId:10665] [53983] (595 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2533328Domain d1l84a_: 1l84 A: [36820]
    complexed with bme, bnz, cl; mutant

Details for d1l84a_

PDB Entry: 1l84 (more details), 1.9 Å

PDB Description: a cavity-containing mutant of t4 lysozyme is stabilized by buried benzene
PDB Compounds: (A:) t4 lysozyme

SCOPe Domain Sequences for d1l84a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l84a_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittartgtwdayk

SCOPe Domain Coordinates for d1l84a_:

Click to download the PDB-style file with coordinates for d1l84a_.
(The format of our PDB-style files is described here.)

Timeline for d1l84a_: