Lineage for d6ic5a_ (6ic5 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2416087Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) (S)
    automatically mapped to Pfam PF08773
  5. 2416088Family b.61.5.1: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75002] (1 protein)
  6. 2416089Protein Dipeptidyl peptidase I (cathepsin C), exclusion domain [75003] (2 species)
  7. 2416090Species Human (Homo sapiens) [TaxId:9606] [75004] (15 PDB entries)
  8. 2416100Domain d6ic5a_: 6ic5 A: [368158]
    automated match to d1k3ba_
    complexed with bma, cl, hb5, man, nag

Details for d6ic5a_

PDB Entry: 6ic5 (more details), 2 Å

PDB Description: human cathepsin-c in complex with dipeptidyl cyclopropyl nitrile inhibitor 2
PDB Compounds: (A:) Dipeptidyl peptidase 1

SCOPe Domain Sequences for d6ic5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ic5a_ b.61.5.1 (A:) Dipeptidyl peptidase I (cathepsin C), exclusion domain {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv

SCOPe Domain Coordinates for d6ic5a_:

Click to download the PDB-style file with coordinates for d6ic5a_.
(The format of our PDB-style files is described here.)

Timeline for d6ic5a_: