Lineage for d6h47a_ (6h47 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868282Domain d6h47a_: 6h47 A: [368156]
    Other proteins in same PDB: d6h47b1, d6h47b2
    automated match to d1r2qa_
    complexed with so4

Details for d6h47a_

PDB Entry: 6h47 (more details), 1.7 Å

PDB Description: human kras in complex with darpin k19
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6h47a_:

Sequence, based on SEQRES records: (download)

>d6h47a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh

Sequence, based on observed residues (ATOM records): (download)

>d6h47a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdedsyrkqvvidgetclldildtagqeeysa
mrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdlpsrtvd
tkqaqdlarsygipfietsaktrqgvddafytlvreirkh

SCOPe Domain Coordinates for d6h47a_:

Click to download the PDB-style file with coordinates for d6h47a_.
(The format of our PDB-style files is described here.)

Timeline for d6h47a_: