Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) |
Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
Protein automated matches [190038] (48 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [334147] (3 PDB entries) |
Domain d6m7gh_: 6m7g H: [368153] automated match to d5jtfa_ complexed with ppq |
PDB Entry: 6m7g (more details), 2.66 Å
SCOPe Domain Sequences for d6m7gh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m7gh_ d.108.1.0 (H:) automated matches {Pseudomonas putida [TaxId: 160488]} gidirvarpedaeeiqiiyapivlntaisfeeavpsveqmreristtlqtypylvavreg rvvgyayasqhraraayrwavdvtvyvaegqrrsgiarqlydvllpvlkrlgyrsayagi alpnegsvglherlgfqhigtfpqvgfkldawhdvgywrfdfgdeglhpeaplg
Timeline for d6m7gh_: