SCOPe 2.08: Domain d6h46a1: 6h46 A:1-166

Lineage for d6h46a1 (6h46 A:1-166)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)

8. Domain d6h46a1: 6h46 A:1-166 [368108]
   Other proteins in same PDB: d6h46a2, d6h46b_
   automated match to d1r2qa_
   complexed with gdp, so4

Details for d6h46a1

PDB Entry: 6h46, 2.22 Å

PDB Description: human kras in complex with darpin k13

PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6h46a1:

Sequence; same for both SEQRES and ATOM records:

>d6h46a1 c.37.1.8 (A:1-166) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh

Timeline for d6h46a1:

• d6h46a1 first appeared in SCOPe 2.07