SCOPe 2.07: Domain d6dy6a_: 6dy6 A:

Lineage for d6dy6a_ (6dy6 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)

8. Domain d6dy6a_: 6dy6 A: [368029]
   automated match to d2bc5a_
   complexed with 1pe, hec, mn

Details for d6dy6a_

PDB Entry: 6dy6, 1.8 Å

PDB Description: mn(ii)-bound structure of the engineered cyt cb562 variant, ch2e

PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d6dy6a_:

Sequence; same for both SEQRES and ATOM records:

>d6dy6a_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemwd
frhgfdhlvghiddalklanegkvkeaqaaaeqlkcecnachqkyr

Timeline for d6dy6a_:

• d6dy6a_ is new in SCOPe 2.07-stable
  
• d6dy6a_ appears in the current release, SCOPe 2.08