Lineage for d137lb_ (137l B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323817Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 323818Protein Phage T4 lysozyme [53982] (1 species)
  7. 323819Species Bacteriophage T4 [TaxId:10665] [53983] (371 PDB entries)
    many mutant structures
  8. 323991Domain d137lb_: 137l B: [36792]
    mutant

Details for d137lb_

PDB Entry: 137l (more details), 1.85 Å

PDB Description: structural basis of amino acid alpha helix propensity

SCOP Domain Sequences for d137lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d137lb_ d.2.1.3 (B:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakfeldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d137lb_:

Click to download the PDB-style file with coordinates for d137lb_.
(The format of our PDB-style files is described here.)

Timeline for d137lb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d137la_