Lineage for d6n42a_ (6n42 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2423915Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2424451Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2424452Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2424453Species Human (Homo sapiens) [TaxId:9606] [159290] (15 PDB entries)
    Uniprot Q16878 6-190
  8. 2424463Domain d6n42a_: 6n42 A: [367850]
    automated match to d6bgfa_
    complexed with cys, fe2, gol, so4

Details for d6n42a_

PDB Entry: 6n42 (more details), 2.2 Å

PDB Description: crystal structure of cysteine-bound ferrous form of the crosslinked human cysteine dioxygenase in the anaerobic condition
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d6n42a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n42a_ b.82.1.19 (A:) Cysteine dioxygenase type I {Human (Homo sapiens) [TaxId: 9606]}
evlkprtladlirilhqlfagdevnveevqaimeayesdptewamyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtnshcflkmlqgnlketlfawpdkksnemvkkserv
lrenqcayindsvglhrvenishtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d6n42a_:

Click to download the PDB-style file with coordinates for d6n42a_.
(The format of our PDB-style files is described here.)

Timeline for d6n42a_: