Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6dfqd1: 6dfq D:3-113 [367794] Other proteins in same PDB: d6dfqa2, d6dfqc2, d6dfqe2, d6dfqg2 automated match to d3o4le1 complexed with ca, edo |
PDB Entry: 6dfq (more details), 2.6 Å
SCOPe Domain Sequences for d6dfqd1:
Sequence, based on SEQRES records: (download)
>d6dfqd1 b.1.1.0 (D:3-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevkslp gadylatrvtdtelrlqvanmsqgrtlyctcsaglgyeqyfgpgtrltvle
>d6dfqd1 b.1.1.0 (D:3-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} lleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevkslp gadylatrvtdtelrlqvanmsqgrtlyctcsagyeqyfgpgtrltvle
Timeline for d6dfqd1: