Lineage for d6dfsc1 (6dfs C:1-83)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2507530Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2507531Protein automated matches [226842] (4 species)
    not a true protein
  7. 2507687Species Mouse (Mus musculus) [TaxId:10090] [224924] (65 PDB entries)
  8. 3067727Domain d6dfsc1: 6dfs C:1-83 [367789]
    Other proteins in same PDB: d6dfsa1, d6dfsa2, d6dfsb1, d6dfsb2, d6dfsc2
    automated match to d5ujta1
    complexed with nag

Details for d6dfsc1

PDB Entry: 6dfs (more details), 3.1 Å

PDB Description: mouse tcr i.29 in complex with iag7-p8e9e6ss
PDB Compounds: (C:) H-2 class II histocompatibility antigen, A-D alpha chain

SCOPe Domain Sequences for d6dfsc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfsc1 d.19.1.0 (C:1-83) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqg
glqciaaekhnlgiltkrsnftp

SCOPe Domain Coordinates for d6dfsc1:

Click to download the PDB-style file with coordinates for d6dfsc1.
(The format of our PDB-style files is described here.)

Timeline for d6dfsc1:

  • d6dfsc1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18