Lineage for d6dfsa1 (6dfs A:1-117)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (670 PDB entries)
  8. 3067709Domain d6dfsa1: 6dfs A:1-117 [367771]
    Other proteins in same PDB: d6dfsa2, d6dfsc1, d6dfsc2
    automated match to d2f54d1
    complexed with nag

Details for d6dfsa1

PDB Entry: 6dfs (more details), 3.1 Å

PDB Description: mouse tcr i.29 in complex with iag7-p8e9e6ss
PDB Compounds: (A:) mouse TCR alpha chain

SCOPe Domain Sequences for d6dfsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfsa1 b.1.1.0 (A:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mekveqhestlsvregdsavinctytdtassyfpwykqeagkglhfvidirsnvdrkqsq
rlivlldkkakrfslhitatqpedsaiyfcaaspsnsggsnykltfgkgtlltvtpn

SCOPe Domain Coordinates for d6dfsa1:

Click to download the PDB-style file with coordinates for d6dfsa1.
(The format of our PDB-style files is described here.)

Timeline for d6dfsa1:

  • d6dfsa1 appears in periodic updates to SCOPe 2.07 starting on 2019-04-18