Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (3 families) |
Family c.41.1.1: Subtilases [52744] (14 proteins) |
Protein automated matches [190073] (16 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [187756] (2 PDB entries) |
Domain d6o44a1: 6o44 A:1-275 [367595] Other proteins in same PDB: d6o44a2, d6o44b2 automated match to d1scja_ complexed with ca, edo, so4 |
PDB Entry: 6o44 (more details), 1.83 Å
SCOPe Domain Sequences for d6o44a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6o44a1 c.41.1.1 (A:1-275) automated matches {Bacillus subtilis [TaxId: 1423]} aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd vinmslggpsgstalktvvdkavssgivvaaaagnegssgssstvgypakypstiavgav nssnqrasfssagseldvmapgvsiqstlpggtygayngtcmatphvagaaalilskhpt wtnaqvrdrlestatylgnsfyygkglinvqaaaq
Timeline for d6o44a1: