Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.3: Crotonase-like [52103] (14 proteins) |
Protein Methylmalonyl CoA decarboxylase [52110] (2 species) |
Species Escherichia coli [TaxId:83333] [367511] (6 PDB entries) |
Domain d6n95d_: 6n95 D: [367559] automated match to d1ef8a_ complexed with k, ni, peg, pg4, pge, yxr, yxs |
PDB Entry: 6n95 (more details), 1.8 Å
SCOPe Domain Sequences for d6n95d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6n95d_ c.14.1.3 (D:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 83333]} ayqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgskv fsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdli iaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhv veveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydse dyqegmnaflekrkpnfvgh
Timeline for d6n95d_: