Lineage for d6n95d_ (6n95 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461344Family c.14.1.3: Crotonase-like [52103] (14 proteins)
  6. 2461476Protein Methylmalonyl CoA decarboxylase [52110] (2 species)
  7. 2461482Species Escherichia coli [TaxId:83333] [367511] (6 PDB entries)
  8. 2461516Domain d6n95d_: 6n95 D: [367559]
    automated match to d1ef8a_
    complexed with k, ni, peg, pg4, pge, yxr, yxs

Details for d6n95d_

PDB Entry: 6n95 (more details), 1.8 Å

PDB Description: methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- coa
PDB Compounds: (D:) Methylmalonyl-CoA decarboxylase

SCOPe Domain Sequences for d6n95d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6n95d_ c.14.1.3 (D:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 83333]}
ayqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgskv
fsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdli
iaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhv
veveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydse
dyqegmnaflekrkpnfvgh

SCOPe Domain Coordinates for d6n95d_:

Click to download the PDB-style file with coordinates for d6n95d_.
(The format of our PDB-style files is described here.)

Timeline for d6n95d_: