SCOPe 2.07: Domain d6n94c_: 6n94 C:

Lineage for d6n94c_ (6n94 C:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.3: Crotonase-like [52103] (14 proteins)

6. Protein Methylmalonyl CoA decarboxylase [52110] (2 species)

7. Species Escherichia coli [TaxId:83333] [367511] (6 PDB entries)

8. Domain d6n94c_: 6n94 C: [367549]
   automated match to d1ef8a_
   complexed with imd, k, kgj, ni, peg, pg4, pge

Details for d6n94c_

PDB Entry: 6n94, 1.75 Å

PDB Description: methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- amino(dethia)-coa

PDB Compounds: (C:) Methylmalonyl-CoA decarboxylase

SCOPe Domain Sequences for d6n94c_:

Sequence; same for both SEQRES and ATOM records:

>d6n94c_ c.14.1.3 (C:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 83333]}
ayqyvnvvtinkvaviefnygrklnalskvfiddlmqalsdlnrpeirciilrapsgskv
fsaghdihelpsggrdplsyddplrqitrmiqkfpkpiismvegsvwggafemimssdli
iaaststfsmtpvnlgvpynlvgihnltrdagfhivkeliftaspitaqralavgilnhv
veveeledftlqmahhisekaplaiavikeelrvlgeahtmnsdeferiqgmrravydse
dyqegmnaflekrkpnfvgh

Timeline for d6n94c_:

• d6n94c_ is new in SCOPe 2.07-stable
  
• d6n94c_ appears in the current release, SCOPe 2.08