SCOPe 2.07: Domain d6iebl2: 6ieb L:107-207

Lineage for d6iebl2 (6ieb L:107-207)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6iebl2: 6ieb L:107-207 [367485]
   Other proteins in same PDB: d6iebf1, d6iebl1
   automated match to d7fabl2

Details for d6iebl2

PDB Entry: 6ieb, 2.41 Å

PDB Description: structure of rvfv gn and human monoclonal antibody r15

PDB Compounds: (L:) R15 L chain

SCOPe Domain Sequences for d6iebl2:

Sequence; same for both SEQRES and ATOM records:

>d6iebl2 b.1.1.2 (L:107-207) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d6iebl2:

• d6iebl2 is new in SCOPe 2.07-stable
  
• d6iebl2 appears in the current release, SCOPe 2.08