SCOPe 2.07: Domain d6g2ue2: 6g2u E:213-501

Lineage for d6g2ue2 (6g2u E:213-501)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein automated matches [227005] (6 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [353659] (4 PDB entries)

8. Domain d6g2ue2: 6g2u E:213-501 [367433]
   Other proteins in same PDB: d6g2ua1, d6g2ub1, d6g2uc1, d6g2ud1, d6g2ue1, d6g2uf1
   automated match to d3etda2
   complexed with cl, na, po4

Details for d6g2ue2

PDB Entry: 6g2u, 2.93 Å

PDB Description: crystal structure of the human glutamate dehydrogenase 2 (hgdh2)

PDB Compounds: (E:) Glutamate dehydrogenase 2, mitochondrial

SCOPe Domain Sequences for d6g2ue2:

Sequence; same for both SEQRES and ATOM records:

>d6g2ue2 c.2.1.7 (E:213-501) automated matches {Homo sapiens [TaxId: 9606]}
hgrisatgrgvfhgienfineasymsilgmtpgfrdktfvvqgfgnvglhsmrylhrfga
kciavgesdgsiwnpdgidpkeledfklqhgsilgfpkakpyegsilevdcdilipaate
kqltksnaprvkakiiaegangpttpeadkiflernilvipdlylnaggvtvsyfewlkn
lnhvsygrltfkyerdsnyhlllsvqeslerkfgkhggtipivptaefqdsisgasekdi
vhsalaytmersarqimhtamkynlgldlrtaayvnaiekvfkvyseag

Timeline for d6g2ue2:

• d6g2ue2 is new in SCOPe 2.07-stable
  
• d6g2ue2 appears in the current release, SCOPe 2.08