Class a: All alpha proteins [46456] (289 folds) |
Fold a.38: HLH-like [47458] (2 superfamilies) 4-helices; bundle, closed, left-handed twist; 2 crossover connections |
Superfamily a.38.1: HLH, helix-loop-helix DNA-binding domain [47459] (2 families) dimer of two identical helix-loop-helix subunits |
Family a.38.1.0: automated matches [324429] (1 protein) not a true family |
Protein automated matches [324430] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [324431] (3 PDB entries) |
Domain d6g6ja_: 6g6j A: [367411] Other proteins in same PDB: d6g6jb_, d6g6jd_ automated match to d5i4za_ complexed with so4 |
PDB Entry: 6g6j (more details), 2.25 Å
SCOPe Domain Sequences for d6g6ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6g6ja_ a.38.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} thnvlerqrrnelkrsffalrdqipelennekapkvvilkkatayilsvqaeeqklisee dllrkrreqlkhkleqlrns
Timeline for d6g6ja_: