SCOPe 2.07: Domain d6cx9a2: 6cx9 A:186-279

Lineage for d6cx9a2 (6cx9 A:186-279)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6cx9a2: 6cx9 A:186-279 [367356]
   Other proteins in same PDB: d6cx9a1, d6cx9b_, d6cx9c2
   automated match to d1zt4c1
   complexed with em4, fuc, na, nag

Details for d6cx9a2

PDB Entry: 6cx9, 2.36 Å

PDB Description: structure of alpha-gsa[16,6p] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cx9a2:

Sequence, based on SEQRES records:

>d6cx9a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d6cx9a2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld
veageeaglacrvkhsslggqdiilyw

Timeline for d6cx9a2:

• d6cx9a2 is new in SCOPe 2.07-stable
  
• d6cx9a2 appears in the current release, SCOPe 2.08