Lineage for d6o7ud_ (6o7u d:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633576Fold f.40: V-type ATP synthase subunit C [103485] (1 superfamily)
    9 transmembrane helices
  4. 2633577Superfamily f.40.1: V-type ATP synthase subunit C [103486] (2 families) (S)
    duplication: consists of three similar structural parts
    automatically mapped to Pfam PF01992
  5. 2633578Family f.40.1.1: V-type ATP synthase subunit C [103487] (2 proteins)
  6. 2633585Protein V-type proton ATPase subunit d [310714] (2 species)
  7. 2633586Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310959] (2 PDB entries)
  8. 2633587Domain d6o7ud_: 6o7u d: [367294]
    Other proteins in same PDB: d6o7ug1, d6o7ug2, d6o7uh1, d6o7uh2, d6o7ui1, d6o7ui2, d6o7uj1, d6o7uj2, d6o7uk1, d6o7uk2, d6o7ul1, d6o7ul2, d6o7um1, d6o7um2, d6o7un1, d6o7un2
    automated match to d3j9tq_

Details for d6o7ud_

PDB Entry: 6o7u (more details), 3.1 Å

PDB Description: saccharomyces cerevisiae v-atpase stv1-vo
PDB Compounds: (d:) V-type proton ATPase subunit D

SCOPe Domain Sequences for d6o7ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o7ud_ f.40.1.1 (d:) V-type proton ATPase subunit d {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gvyfnidngfiegvvrgyrngllsnnqyinltqcdtledlklqlsstdygnflssvsses
lttsliqeyassklyhefnyirdqssgstrkfmdyitygymidnvalmitgtihdrdkge
ilqrchplgwfdtlptlsvatdleslyetvlvdtplapyfkncfdtaeelddmnieiirn
klykayledfynfvteeipepakecmqtllgfeadrrsinialnslqssdidpdlksdll
pnigklyplatfhlaqaqdfegvraalanvyeyrgfletgnledhfyqlemelcrdaftq
qfaistvwawmkskeqevrnitwiaeciaqnqrerinnyisvy

SCOPe Domain Coordinates for d6o7ud_:

Click to download the PDB-style file with coordinates for d6o7ud_.
(The format of our PDB-style files is described here.)

Timeline for d6o7ud_: