SCOPe 2.07: Domain d5zz3a1: 5zz3 A:298-485

Lineage for d5zz3a1 (5zz3 A:298-485)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)

8. Domain d5zz3a1: 5zz3 A:298-485 [367274]
   Other proteins in same PDB: d5zz3a2
   automated match to d5lyga_

Details for d5zz3a1

PDB Entry: 5zz3, 3 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a3

PDB Compounds: (A:) Butyrophilin, subfamily 3, member A3 isoform b variant

SCOPe Domain Sequences for d5zz3a1:

Sequence; same for both SEQRES and ATOM records:

>d5zz3a1 b.29.1.0 (A:298-485) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewrycvlgc
enftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyralte
prtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltlept
alticpip

Timeline for d5zz3a1:

• d5zz3a1 is new in SCOPe 2.07-stable
  
• d5zz3a1 appears in the current release, SCOPe 2.08