SCOP 1.65: Domain d186l__: 186l -

Lineage for d186l__ (186l -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (7 families)

5. Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (371 PDB entries)
   many mutant structures

8. Domain d186l__: 186l - [36723]
   complexed with cl, hed, n4b; mutant

Details for d186l__

PDB Entry: 186l, 1.8 Å

PDB Description: specificity of ligand binding in a buried non-polar cavity of t4 lysozyme: linkage of dynamics and structural plasticity

SCOP Domain Sequences for d186l__:

Sequence; same for both SEQRES and ATOM records:

>d186l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk

Timeline for d186l__:

• d186l__ first appeared (with stable ids) in SCOP 1.55
  
• d186l__ appears in SCOP 1.63
  
• d186l__ appears in SCOP 1.67
  
• d186l__ appears in the current release, SCOPe 2.08, called d186la_