SCOPe 2.07: Domain d6ivea1: 6ive A:2-168

Lineage for d6ivea1 (6ive A:2-168)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (35 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [367129] (1 PDB entry)

8. Domain d6ivea1: 6ive A:2-168 [367156]
   Other proteins in same PDB: d6ivea2, d6ivef2
   automated match to d1v3wa_
   complexed with po4, zn

Details for d6ivea1

PDB Entry: 6ive, 2.3 Å

PDB Description: molecular structure of a thermostable and a zinc ion binding gamma- class carbonic anhydrase

PDB Compounds: (A:) Ferripyochelin-binding protein

SCOPe Domain Sequences for d6ivea1:

Sequence; same for both SEQRES and ATOM records:

>d6ivea1 b.81.1.0 (A:2-168) automated matches {Thermus thermophilus [TaxId: 300852]}
svyrfedktpavhptafiapgayvvgavevgegasiwfgavvrgdlervvvgpgtnvqdg
avlhadpgfpcllgpevtvghravvhgavveegalvgmgavvlngarigknavvgagavv
ppgmevpegrlalgvparvvrpidppgnapryralaeryrkalfpva

Timeline for d6ivea1:

• d6ivea1 is new in SCOPe 2.07-stable
  
• d6ivea1 appears in the current release, SCOPe 2.08