Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (50 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [234564] (7 PDB entries) |
Domain d6hcub1: 6hcu B:78-228 [367120] Other proteins in same PDB: d6hcua2, d6hcub2 automated match to d3bjua1 complexed with fyb, his, lys, peg, trs |
PDB Entry: 6hcu (more details), 1.62 Å
SCOPe Domain Sequences for d6hcub1:
Sequence, based on SEQRES records: (download)
>d6hcub1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 36329]} vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg kskkgelsifpketillsaclhmlpmkyglk
>d6hcub1 b.40.4.0 (B:78-228) automated matches {Plasmodium falciparum [TaxId: 36329]} vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg rimrvsaqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks kkgelsifpketillsaclhmlpmkyglk
Timeline for d6hcub1: