SCOPe 2.07: Domain d6hcwb1: 6hcw B:46-189

Lineage for d6hcwb1 (6hcw B:46-189)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (50 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [326193] (5 PDB entries)

8. Domain d6hcwb1: 6hcw B:46-189 [367092]
   Other proteins in same PDB: d6hcwa2, d6hcwa3, d6hcwb2, d6hcwb3
   automated match to d5elna1
   protein/RNA complex; complexed with fyb, lys, trs

Details for d6hcwb1

PDB Entry: 6hcw, 1.46 Å

PDB Description: crystal structure of lysyl-trna synthetase from cryptosporidium parvum complexed with l-lysine and a difluoro cyclohexyl chromone ligand

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6hcwb1:

Sequence; same for both SEQRES and ATOM records:

>d6hcwb1 b.40.4.0 (B:46-189) automated matches {Cryptosporidium parvum [TaxId: 353152]}
hytdnrykmmecikdagrpfyphkfkismslpayalkygnvengyidkdttlslsgrvts
irssssklifydifceeqkvqiianimehdistgefsvshseirrgdvvgftgfpgkskr
gelslfsksvvllspcyhmlptai

Timeline for d6hcwb1:

• d6hcwb1 is new in SCOPe 2.07-stable
  
• d6hcwb1 appears in the current release, SCOPe 2.08