Lineage for d245l__ (245l -)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 323287Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 323288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 323817Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 323818Protein Phage T4 lysozyme [53982] (1 species)
  7. 323819Species Bacteriophage T4 [TaxId:10665] [53983] (371 PDB entries)
    many mutant structures
  8. 323924Domain d245l__: 245l - [36705]
    complexed with cl, hed; mutant

Details for d245l__

PDB Entry: 245l (more details), 1.8 Å

PDB Description: the response of t4 lysozyme to large-to-small substitutions within the core and its relation to the hydrophobic effect

SCOP Domain Sequences for d245l__:

Sequence; same for both SEQRES and ATOM records: (download)

>d245l__ d.2.1.3 (-) Phage T4 lysozyme {Bacteriophage T4}
mnifealrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

SCOP Domain Coordinates for d245l__:

Click to download the PDB-style file with coordinates for d245l__.
(The format of our PDB-style files is described here.)

Timeline for d245l__: