Lineage for d6r1ed_ (6r1e D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613889Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 2613923Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 2614025Family d.230.2.0: automated matches [191578] (1 protein)
    not a true family
  6. 2614026Protein automated matches [191015] (5 species)
    not a true protein
  7. 2614068Species Streptomyces coelicolor [TaxId:100226] [366935] (1 PDB entry)
  8. 2614072Domain d6r1ed_: 6r1e D: [366936]
    automated match to d3oqta_
    complexed with cl, coa, fmn, na, so4

Details for d6r1ed_

PDB Entry: 6r1e (more details), 2.6 Å

PDB Description: structure of dodecin from streptomyces coelicolor
PDB Compounds: (D:) dodecin

SCOPe Domain Sequences for d6r1ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6r1ed_ d.230.2.0 (D:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
msnhtyrvtevvgtspdgvdqavrnavtrasqtlrkldwfevtqvrgqiedgqvahwqvg
lklgfrlees

SCOPe Domain Coordinates for d6r1ed_:

Click to download the PDB-style file with coordinates for d6r1ed_.
(The format of our PDB-style files is described here.)

Timeline for d6r1ed_: