Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.230: Dodecin subunit-like [88797] (6 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
Superfamily d.230.2: Dodecin-like [89807] (2 families) |
Family d.230.2.0: automated matches [191578] (1 protein) not a true family |
Protein automated matches [191015] (5 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [366935] (1 PDB entry) |
Domain d6r1ed_: 6r1e D: [366936] automated match to d3oqta_ complexed with cl, coa, fmn, na, so4 |
PDB Entry: 6r1e (more details), 2.6 Å
SCOPe Domain Sequences for d6r1ed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6r1ed_ d.230.2.0 (D:) automated matches {Streptomyces coelicolor [TaxId: 100226]} msnhtyrvtevvgtspdgvdqavrnavtrasqtlrkldwfevtqvrgqiedgqvahwqvg lklgfrlees
Timeline for d6r1ed_: