SCOPe 2.07: Domain d6mtql1: 6mtq L:1-105

Lineage for d6mtql1 (6mtq L:1-105)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6mtql1: 6mtq L:1-105 [366922]
   Other proteins in same PDB: d6mtqt_
   automated match to d3u7wl1

Details for d6mtql1

PDB Entry: 6mtq, 2.7 Å

PDB Description: crystal structure of vrc42.n1 fab in complex with t117-f mper scaffold

PDB Compounds: (L:) Antibody VRC42.N1 Fab light chain

SCOPe Domain Sequences for d6mtql1:

Sequence; same for both SEQRES and ATOM records:

>d6mtql1 b.1.1.0 (L:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspdtlslspgeratlscrasqsvgssyfawyqqkpgqaprlliygastratgip
grfsgsgsgtdftlaitrvepedfavyycqqfdkshvtfgqgtkve

Timeline for d6mtql1:

• d6mtql1 is new in SCOPe 2.07-stable
  
• d6mtql1 appears in the current release, SCOPe 2.08