Lineage for d6fz2b1 (6fz2 B:116-295)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2575675Species Human (Homo sapiens) [TaxId:9606] [225745] (54 PDB entries)
  8. 2575745Domain d6fz2b1: 6fz2 B:116-295 [366790]
    automated match to d3iu1a1
    complexed with 31a, gol, mg, mya

Details for d6fz2b1

PDB Entry: 6fz2 (more details), 2.05 Å

PDB Description: human n-myristoyltransferase (nmt1) with myristoyl-coa and inhibitor bound
PDB Compounds: (B:) Glycylpeptide N-tetradecanoyltransferase 1

SCOPe Domain Sequences for d6fz2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fz2b1 d.108.1.0 (B:116-295) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syqfwdtqpvpklgevvnthgpvepdkdnirqepytlpqgftwdaldlgdrgvlkelytl
lnenyvedddnmfrfdyspefllwalrppgwlpqwhcgvrvvssrklvgfisaipanihi
ydtekkmveinflcvhkklrskrvapvlireitrrvhlegifqavytagvvlpkpvgtcr

SCOPe Domain Coordinates for d6fz2b1:

Click to download the PDB-style file with coordinates for d6fz2b1.
(The format of our PDB-style files is described here.)

Timeline for d6fz2b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fz2b2