SCOPe 2.07: Domain d6a4kn2: 6a4k N:113-217

Lineage for d6a4kn2 (6a4k N:113-217)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
Domain d6a4kn2: 6a4k N:113-217 [366753]
Other proteins in same PDB: d6a4kl1, d6a4km1, d6a4kn1, d6a4ko1
automated match to d1jvka2
complexed with act, ca, nag

Details for d6a4kn2

PDB Entry: 6a4k (more details), 3.15 Å

PDB Description: human antibody 32d6 fab in complex with h1n1 influenza a virus ha1

PDB Compounds: (N:) Immunoglobulin Fab light chain

SCOPe Domain Sequences for d6a4kn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6a4kn2 b.1.1.2 (N:113-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qskaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs

SCOPe Domain Coordinates for d6a4kn2:

Click to download the PDB-style file with coordinates for d6a4kn2.
(The format of our PDB-style files is described here.)

Timeline for d6a4kn2: