Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Hypocrea jecorina [TaxId:1344414] [365691] (8 PDB entries) |
Domain d5zh9a_: 5zh9 A: [366694] automated match to d4xqdb_ complexed with iod; mutant |
PDB Entry: 5zh9 (more details), 1.15 Å
SCOPe Domain Sequences for d5zh9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zh9a_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 1344414]} tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin fsgsynpngnsylsvygwsrnplieyfivenfgtynpstgatklgevtsdgsvydiyrtq rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs sgsasitvs
Timeline for d5zh9a_: