Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily) 2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array |
Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) |
Family e.22.1.0: automated matches [191565] (1 protein) not a true family |
Protein automated matches [190982] (12 species) not a true protein |
Species Escherichia coli [TaxId:83333] [366668] (1 PDB entry) |
Domain d5zxld_: 5zxl D: [366670] automated match to d4mcaa_ complexed with cl, gol, so4, zn |
PDB Entry: 5zxl (more details), 2.79 Å
SCOPe Domain Sequences for d5zxld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5zxld_ e.22.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]} mdriiqspgkyiqgadvinrlgeylkplaerwlvvgdkfvlgfaqstveksfkdaglvve iapfggecsqneidrlrgiaetaqcgailgigggktldtakalahfmgvpvaiaptiast dapcsalsviytdegefdrylllpnnpnmvivdtkivagaparllaagigdalatwfear acsrsgattmaggkctqaalalaelcyntlleegekamlaaeqhvvtpalervieantyl sgvgfesgglaaahavhngltaipdahhyyhgekvafgtltqlvlenapveeietvaals havglpitlaqldikedvpakmrivaeaacaegetihnmpggatpdqvyaallvadqygq rflqewe
Timeline for d5zxld_: