Lineage for d5zj8a_ (5zj8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603630Species Klebsiella pneumoniae [TaxId:573] [189718] (103 PDB entries)
  8. 2603644Domain d5zj8a_: 5zj8 A: [366664]
    automated match to d5zh1b_
    complexed with 9dc, edo, zn

Details for d5zj8a_

PDB Entry: 5zj8 (more details), 0.96 Å

PDB Description: crystal structure of ndm-1 in complex with d-captopril derivative cy32
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5zj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zj8a_ d.157.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
gdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvvdtawtddqtaqi
lnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqlapqegmvaaqhsl
tfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggclikdskakslgnl
gdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadklr

SCOPe Domain Coordinates for d5zj8a_:

Click to download the PDB-style file with coordinates for d5zj8a_.
(The format of our PDB-style files is described here.)

Timeline for d5zj8a_: