Lineage for d6nkne_ (6nkn E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727193Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) (S)
    automatically mapped to Pfam PF02284
  5. 2727194Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2727195Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 2727196Species Cow (Bos taurus) [TaxId:9913] [48482] (50 PDB entries)
  8. 2727285Domain d6nkne_: 6nkn E: [366644]
    Other proteins in same PDB: d6nkna_, d6nknb1, d6nknb2, d6nknc_, d6nknd_, d6nknf_, d6nkng_, d6nknh_, d6nkni_, d6nknj_, d6nknk_, d6nknl_, d6nknm_, d6nknn_, d6nkno1, d6nkno2, d6nknp_, d6nknq_, d6nkns_, d6nknt_, d6nknu_, d6nknv_, d6nknw_, d6nknx_, d6nkny_, d6nknz_
    automated match to d1v54e_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, o, oh, pek, pgv, psc, tgl, zn

Details for d6nkne_

PDB Entry: 6nkn (more details), 2.5 Å

PDB Description: time-resolved sfx structure of the pr intermediate of cytochrome c oxidase at room temperature
PDB Compounds: (E:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d6nkne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nkne_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d6nkne_:

Click to download the PDB-style file with coordinates for d6nkne_.
(The format of our PDB-style files is described here.)

Timeline for d6nkne_: