SCOPe 2.07: Domain d6o98b1: 6o98 B:244-465

Lineage for d6o98b1 (6o98 B:244-465)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)

8. Domain d6o98b1: 6o98 B:244-465 [366633]
   Other proteins in same PDB: d6o98b2
   automated match to d5ntwa_
   complexed with l8a

Details for d6o98b1

PDB Entry: 6o98, 2.29 Å

PDB Description: crystal structure of rar-related orphan receptor c in complex with a phenyl (3-phenylpyrrolidin-3-yl)sulfone inhibitor

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d6o98b1:

Sequence; same for both SEQRES and ATOM records:

>d6o98b1 a.123.1.0 (B:244-465) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqif

Timeline for d6o98b1:

• d6o98b1 is new in SCOPe 2.07-stable
  
• d6o98b1 appears in the current release, SCOPe 2.08