SCOPe 2.07: Domain d6fv9a_: 6fv9 A:

Lineage for d6fv9a_ (6fv9 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)

8. Domain d6fv9a_: 6fv9 A: [366459]
   automated match to d4i15a_
   complexed with e8h, gol, mg, zn

Details for d6fv9a_

PDB Entry: 6fv9, 2.48 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-007

PDB Compounds: (A:) phosphodiesterase

SCOPe Domain Sequences for d6fv9a_:

Sequence; same for both SEQRES and ATOM records:

>d6fv9a_ a.211.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervletr

Timeline for d6fv9a_:

• d6fv9a_ is new in SCOPe 2.07-stable
  
• d6fv9a_ appears in the current release, SCOPe 2.08