Lineage for d6agpa_ (6agp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475716Protein Rac [52595] (1 species)
  7. 2475717Species Human (Homo sapiens) [TaxId:9606] [52596] (41 PDB entries)
  8. 2475775Domain d6agpa_: 6agp A: [366447]
    automated match to d1ryha_
    complexed with gdp, mg

Details for d6agpa_

PDB Entry: 6agp (more details)

PDB Description: structure of rac1 in the low-affinity state for mg2+
PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 1

SCOPe Domain Sequences for d6agpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6agpa_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgcyiptvfdnysanvmvdgkpvnlglwdtag
qecydrlrplsypctdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
ddkdtieklkekkltpitypqglamakeigavkylecsactqrglktvfdeairavlcpp
p

SCOPe Domain Coordinates for d6agpa_:

Click to download the PDB-style file with coordinates for d6agpa_.
(The format of our PDB-style files is described here.)

Timeline for d6agpa_: