Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (20 species) not a true protein |
Species Saxidomus purpuratus [TaxId:311201] [366413] (3 PDB entries) |
Domain d6a7ta_: 6a7t A: [366414] automated match to d2bpdb_ complexed with ca |
PDB Entry: 6a7t (more details), 1.6 Å
SCOPe Domain Sequences for d6a7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6a7ta_ d.169.1.0 (A:) automated matches {Saxidomus purpuratus [TaxId: 311201]} cckcdcqsgwewfggscylfdetergwedsktfcesqnaalvtvesseeddfirgvisaq safhyywiggswdaehseyrwidgssisfngwgpnrpdadegcmdylnykeivwqwndhq dcvntkgpsicetdcse
Timeline for d6a7ta_: