SCOPe 2.07: Domain d6a7ta_: 6a7t A:

Lineage for d6a7ta_ (6a7t A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (20 species)
   not a true protein

7. Species Saxidomus purpuratus [TaxId:311201] [366413] (3 PDB entries)

8. Domain d6a7ta_: 6a7t A: [366414]
   automated match to d2bpdb_
   complexed with ca

Details for d6a7ta_

PDB Entry: 6a7t, 1.6 Å

PDB Description: ca2+-independent c-type lectin spl-1 from saxidomus purpuratus

PDB Compounds: (A:) N-acetylglucosamine-specific lectin

SCOPe Domain Sequences for d6a7ta_:

Sequence; same for both SEQRES and ATOM records:

>d6a7ta_ d.169.1.0 (A:) automated matches {Saxidomus purpuratus [TaxId: 311201]}
cckcdcqsgwewfggscylfdetergwedsktfcesqnaalvtvesseeddfirgvisaq
safhyywiggswdaehseyrwidgssisfngwgpnrpdadegcmdylnykeivwqwndhq
dcvntkgpsicetdcse

Timeline for d6a7ta_:

• d6a7ta_ is new in SCOPe 2.07-stable
  
• d6a7ta_ appears in the current release, SCOPe 2.08