SCOPe 2.07: Domain d6dyya1: 6dyy A:1-230

Lineage for d6dyya1 (6dyy A:1-230)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (45 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [332654] (9 PDB entries)

8. Domain d6dyya1: 6dyy A:1-230 [366364]
   Other proteins in same PDB: d6dyya2, d6dyyd2
   automated match to d4bn0b_
   complexed with edo, mg, os6

Details for d6dyya1

PDB Entry: 6dyy, 1.61 Å

PDB Description: crystal structure of helicobacter pylori 5'-methylthioadenosine/s- adenosyl homocysteine nucleosidase (mtan) complexed with (3r,4s)-1- ((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)-4-(((3-(1-butyl-1h- 1,2,3-triazol-4-yl)propyl)thio)methyl)pyrrolidin-3-ol

PDB Compounds: (A:) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase

SCOPe Domain Sequences for d6dyya1:

Sequence; same for both SEQRES and ATOM records:

>d6dyya1 c.56.2.0 (A:1-230) automated matches {Helicobacter pylori [TaxId: 210]}
vqkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstlt
ttsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaif
ietsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasva
fvcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

Timeline for d6dyya1:

• d6dyya1 is new in SCOPe 2.07-stable
  
• d6dyya1 appears in the current release, SCOPe 2.08